Package Bio :: Module Seq :: Class Seq
[hide private]
[frames] | no frames]

Class Seq

source code

object --+
         |
        Seq
Known Subclasses:

A read-only sequence object (essentially a string with an alphabet).

Like normal python strings, our basic sequence object is immutable. This prevents you from doing my_seq[5] = "A" for example, but does allow Seq objects to be used as dictionary keys.

The Seq object provides a number of string like methods (such as count, find, split and strip), which are alphabet aware where appropriate.

In addition to the string like sequence, the Seq object has an alphabet property. This is an instance of an Alphabet class from Bio.Alphabet, for example generic DNA, or IUPAC DNA. This describes the type of molecule (e.g. RNA, DNA, protein) and may also indicate the expected symbols (letters).

The Seq object also provides some biological methods, such as complement, reverse_complement, transcribe, back_transcribe and translate (which are not applicable to sequences with a protein alphabet).

Instance Methods [hide private]
 
__init__(self, data, alphabet=Alphabet())
Create a Seq object.
source code
 
__repr__(self)
Returns a (truncated) representation of the sequence for debugging.
source code
 
__str__(self)
Returns the full sequence as a python string, use str(my_seq).
source code
 
__hash__(self)
Hash for comparison.
source code
 
__cmp__(self, other)
Compare the sequence to another sequence or a string (README).
source code
 
__len__(self)
Returns the length of the sequence, use len(my_seq).
source code
 
__getitem__(self, index)
Returns a subsequence of single letter, use my_seq[index].
source code
 
__add__(self, other)
Add another sequence or string to this sequence.
source code
 
__radd__(self, other)
Adding a sequence on the left.
source code
 
tostring(self)
Returns the full sequence as a python string (semi-obsolete).
source code
 
tomutable(self)
Returns the full sequence as a MutableSeq object.
source code
 
_get_seq_str_and_check_alphabet(self, other_sequence)
string/Seq/MutableSeq to string, checking alphabet (PRIVATE).
source code
 
count(self, sub, start=0, end=2147483647)
Non-overlapping count method, like that of a python string.
source code
 
__contains__(self, char)
Implements the 'in' keyword, like a python string.
source code
 
find(self, sub, start=0, end=2147483647)
Find method, like that of a python string.
source code
 
rfind(self, sub, start=0, end=2147483647)
Find from right method, like that of a python string.
source code
 
startswith(self, prefix, start=0, end=2147483647)
Does the Seq start with the given prefix? Returns True/False.
source code
 
endswith(self, suffix, start=0, end=2147483647)
Does the Seq end with the given suffix? Returns True/False.
source code
 
split(self, sep=None, maxsplit=-1)
Split method, like that of a python string.
source code
 
rsplit(self, sep=None, maxsplit=-1)
Right split method, like that of a python string.
source code
 
strip(self, chars=None)
Returns a new Seq object with leading and trailing ends stripped.
source code
 
lstrip(self, chars=None)
Returns a new Seq object with leading (left) end stripped.
source code
 
rstrip(self, chars=None)
Returns a new Seq object with trailing (right) end stripped.
source code
 
upper(self)
Returns an upper case copy of the sequence.
source code
 
lower(self)
Returns a lower case copy of the sequence.
source code
 
complement(self)
Returns the complement sequence.
source code
 
reverse_complement(self)
Returns the reverse complement sequence.
source code
 
transcribe(self)
Returns the RNA sequence from a DNA sequence.
source code
 
back_transcribe(self)
Returns the DNA sequence from an RNA sequence.
source code
 
translate(self, table='Standard', stop_symbol='*', to_stop=False, cds=False)
Turns a nucleotide sequence into a protein sequence.
source code
 
ungap(self, gap=None)
Return a copy of the sequence without the gap character(s).
source code

Inherited from object: __delattr__, __format__, __getattribute__, __new__, __reduce__, __reduce_ex__, __setattr__, __sizeof__, __subclasshook__

Properties [hide private]
  data
Sequence as a string (DEPRECATED).

Inherited from object: __class__

Method Details [hide private]

__init__(self, data, alphabet=Alphabet())
(Constructor)

source code 

Create a Seq object.

Arguments:

  • seq - Sequence, required (string)
  • alphabet - Optional argument, an Alphabet object from Bio.Alphabet

You will typically use Bio.SeqIO to read in sequences from files as SeqRecord objects, whose sequence will be exposed as a Seq object via the seq property.

However, will often want to create your own Seq objects directly:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC
>>> my_seq = Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF",
...              IUPAC.protein)
>>> my_seq
Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF', IUPACProtein())
>>> print my_seq
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
>>> my_seq.alphabet
IUPACProtein()
Overrides: object.__init__

__repr__(self)
(Representation operator)

source code 

Returns a (truncated) representation of the sequence for debugging.

Overrides: object.__repr__

__str__(self)
(Informal representation operator)

source code 

Returns the full sequence as a python string, use str(my_seq).

Note that Biopython 1.44 and earlier would give a truncated version of repr(my_seq) for str(my_seq). If you are writing code which need to be backwards compatible with old Biopython, you should continue to use my_seq.tostring() rather than str(my_seq).

Overrides: object.__str__

__hash__(self)
(Hashing function)

source code 

Hash for comparison.

See the __cmp__ documentation - we plan to change this!

Overrides: object.__hash__

__cmp__(self, other)
(Comparison operator)

source code 

Compare the sequence to another sequence or a string (README).

Historically comparing Seq objects has done Python object comparison. After considerable discussion (keeping in mind constraints of the Python language, hashes and dictionary support) a future release of Biopython will change this to use simple string comparison. The plan is that comparing incompatible alphabets (e.g. DNA to RNA) will trigger a warning.

This version of Biopython still does Python object comparison, but with a warning about this future change. During this transition period, please just do explicit comparisons:

>>> seq1 = Seq("ACGT")
>>> seq2 = Seq("ACGT")
>>> id(seq1) == id(seq2)
False
>>> str(seq1) == str(seq2)
True

Note - This method indirectly supports ==, < , etc.

__add__(self, other)
(Addition operator)

source code 

Add another sequence or string to this sequence.

If adding a string to a Seq, the alphabet is preserved:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_protein
>>> Seq("MELKI", generic_protein) + "LV"
Seq('MELKILV', ProteinAlphabet())

When adding two Seq (like) objects, the alphabets are important. Consider this example:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet.IUPAC import unambiguous_dna, ambiguous_dna
>>> unamb_dna_seq = Seq("ACGT", unambiguous_dna)
>>> ambig_dna_seq = Seq("ACRGT", ambiguous_dna)
>>> unamb_dna_seq
Seq('ACGT', IUPACUnambiguousDNA())
>>> ambig_dna_seq
Seq('ACRGT', IUPACAmbiguousDNA())

If we add the ambiguous and unambiguous IUPAC DNA alphabets, we get the more general ambiguous IUPAC DNA alphabet:

>>> unamb_dna_seq + ambig_dna_seq
Seq('ACGTACRGT', IUPACAmbiguousDNA())

However, if the default generic alphabet is included, the result is a generic alphabet:

>>> Seq("") + ambig_dna_seq
Seq('ACRGT', Alphabet())

You can't add RNA and DNA sequences:

>>> from Bio.Alphabet import generic_dna, generic_rna
>>> Seq("ACGT", generic_dna) + Seq("ACGU", generic_rna)
Traceback (most recent call last):
   ...
TypeError: Incompatible alphabets DNAAlphabet() and RNAAlphabet()

You can't add nucleotide and protein sequences:

>>> from Bio.Alphabet import generic_dna, generic_protein
>>> Seq("ACGT", generic_dna) + Seq("MELKI", generic_protein)
Traceback (most recent call last):
   ...
TypeError: Incompatible alphabets DNAAlphabet() and ProteinAlphabet()

__radd__(self, other)
(Right-side addition operator)

source code 

Adding a sequence on the left.

If adding a string to a Seq, the alphabet is preserved:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_protein
>>> "LV" + Seq("MELKI", generic_protein)
Seq('LVMELKI', ProteinAlphabet())

Adding two Seq (like) objects is handled via the __add__ method.

tostring(self)

source code 

Returns the full sequence as a python string (semi-obsolete).

Although not formally deprecated, you are now encouraged to use str(my_seq) instead of my_seq.tostring().

tomutable(self)

source code 

Returns the full sequence as a MutableSeq object.

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC
>>> my_seq = Seq("MKQHKAMIVALIVICITAVVAAL",
...              IUPAC.protein)
>>> my_seq
Seq('MKQHKAMIVALIVICITAVVAAL', IUPACProtein())
>>> my_seq.tomutable()
MutableSeq('MKQHKAMIVALIVICITAVVAAL', IUPACProtein())

Note that the alphabet is preserved.

_get_seq_str_and_check_alphabet(self, other_sequence)

source code 

string/Seq/MutableSeq to string, checking alphabet (PRIVATE).

For a string argument, returns the string.

For a Seq or MutableSeq, it checks the alphabet is compatible (raising an exception if it isn't), and then returns a string.

count(self, sub, start=0, end=2147483647)

source code 

Non-overlapping count method, like that of a python string.

This behaves like the python string method of the same name, which does a non-overlapping count!

Returns an integer, the number of occurrences of substring argument sub in the (sub)sequence given by [start:end]. Optional arguments start and end are interpreted as in slice notation.

Arguments:

  • sub - a string or another Seq object to look for
  • start - optional integer, slice start
  • end - optional integer, slice end

e.g.

>>> from Bio.Seq import Seq
>>> my_seq = Seq("AAAATGA")
>>> print my_seq.count("A")
5
>>> print my_seq.count("ATG")
1
>>> print my_seq.count(Seq("AT"))
1
>>> print my_seq.count("AT", 2, -1)
1

HOWEVER, please note because python strings and Seq objects (and MutableSeq objects) do a non-overlapping search, this may not give the answer you expect:

>>> "AAAA".count("AA")
2
>>> print Seq("AAAA").count("AA")
2

A non-overlapping search would give the answer as three!

__contains__(self, char)
(In operator)

source code 

Implements the 'in' keyword, like a python string.

e.g.

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_dna, generic_rna, generic_protein
>>> my_dna = Seq("ATATGAAATTTGAAAA", generic_dna)
>>> "AAA" in my_dna
True
>>> Seq("AAA") in my_dna
True
>>> Seq("AAA", generic_dna) in my_dna
True

Like other Seq methods, this will raise a type error if another Seq (or Seq like) object with an incompatible alphabet is used:

>>> Seq("AAA", generic_rna) in my_dna
Traceback (most recent call last):
   ...
TypeError: Incompatable alphabets DNAAlphabet() and RNAAlphabet()
>>> Seq("AAA", generic_protein) in my_dna
Traceback (most recent call last):
   ...
TypeError: Incompatable alphabets DNAAlphabet() and ProteinAlphabet()

find(self, sub, start=0, end=2147483647)

source code 

Find method, like that of a python string.

This behaves like the python string method of the same name.

Returns an integer, the index of the first occurrence of substring argument sub in the (sub)sequence given by [start:end].

Arguments:

  • sub - a string or another Seq object to look for
  • start - optional integer, slice start
  • end - optional integer, slice end

Returns -1 if the subsequence is NOT found.

e.g. Locating the first typical start codon, AUG, in an RNA sequence:

>>> from Bio.Seq import Seq
>>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG")
>>> my_rna.find("AUG")
3

rfind(self, sub, start=0, end=2147483647)

source code 

Find from right method, like that of a python string.

This behaves like the python string method of the same name.

Returns an integer, the index of the last (right most) occurrence of substring argument sub in the (sub)sequence given by [start:end].

Arguments:

  • sub - a string or another Seq object to look for
  • start - optional integer, slice start
  • end - optional integer, slice end

Returns -1 if the subsequence is NOT found.

e.g. Locating the last typical start codon, AUG, in an RNA sequence:

>>> from Bio.Seq import Seq
>>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG")
>>> my_rna.rfind("AUG")
15

startswith(self, prefix, start=0, end=2147483647)

source code 

Does the Seq start with the given prefix? Returns True/False.

This behaves like the python string method of the same name.

Return True if the sequence starts with the specified prefix (a string or another Seq object), False otherwise. With optional start, test sequence beginning at that position. With optional end, stop comparing sequence at that position. prefix can also be a tuple of strings to try. e.g.

>>> from Bio.Seq import Seq
>>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG")
>>> my_rna.startswith("GUC")
True
>>> my_rna.startswith("AUG")
False
>>> my_rna.startswith("AUG", 3)
True
>>> my_rna.startswith(("UCC","UCA","UCG"),1)
True

endswith(self, suffix, start=0, end=2147483647)

source code 

Does the Seq end with the given suffix? Returns True/False.

This behaves like the python string method of the same name.

Return True if the sequence ends with the specified suffix (a string or another Seq object), False otherwise. With optional start, test sequence beginning at that position. With optional end, stop comparing sequence at that position. suffix can also be a tuple of strings to try. e.g.

>>> from Bio.Seq import Seq
>>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG")
>>> my_rna.endswith("UUG")
True
>>> my_rna.endswith("AUG")
False
>>> my_rna.endswith("AUG", 0, 18)
True
>>> my_rna.endswith(("UCC","UCA","UUG"))
True

split(self, sep=None, maxsplit=-1)

source code 

Split method, like that of a python string.

This behaves like the python string method of the same name.

Return a list of the 'words' in the string (as Seq objects), using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If maxsplit is ommited, all splits are made.

Following the python string method, sep will by default be any white space (tabs, spaces, newlines) but this is unlikely to apply to biological sequences.

e.g.

>>> from Bio.Seq import Seq
>>> my_rna = Seq("GUCAUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAGUUG")
>>> my_aa = my_rna.translate()
>>> my_aa
Seq('VMAIVMGR*KGAR*L', HasStopCodon(ExtendedIUPACProtein(), '*'))
>>> my_aa.split("*")
[Seq('VMAIVMGR', HasStopCodon(ExtendedIUPACProtein(), '*')), Seq('KGAR', HasStopCodon(ExtendedIUPACProtein(), '*')), Seq('L', HasStopCodon(ExtendedIUPACProtein(), '*'))]
>>> my_aa.split("*",1)
[Seq('VMAIVMGR', HasStopCodon(ExtendedIUPACProtein(), '*')), Seq('KGAR*L', HasStopCodon(ExtendedIUPACProtein(), '*'))]

See also the rsplit method:

>>> my_aa.rsplit("*",1)
[Seq('VMAIVMGR*KGAR', HasStopCodon(ExtendedIUPACProtein(), '*')), Seq('L', HasStopCodon(ExtendedIUPACProtein(), '*'))]

rsplit(self, sep=None, maxsplit=-1)

source code 

Right split method, like that of a python string.

This behaves like the python string method of the same name.

Return a list of the 'words' in the string (as Seq objects), using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done COUNTING FROM THE RIGHT. If maxsplit is ommited, all splits are made.

Following the python string method, sep will by default be any white space (tabs, spaces, newlines) but this is unlikely to apply to biological sequences.

e.g. print my_seq.rsplit("*",1)

See also the split method.

strip(self, chars=None)

source code 

Returns a new Seq object with leading and trailing ends stripped.

This behaves like the python string method of the same name.

Optional argument chars defines which characters to remove. If ommitted or None (default) then as for the python string method, this defaults to removing any white space.

e.g. print my_seq.strip("-")

See also the lstrip and rstrip methods.

lstrip(self, chars=None)

source code 

Returns a new Seq object with leading (left) end stripped.

This behaves like the python string method of the same name.

Optional argument chars defines which characters to remove. If ommitted or None (default) then as for the python string method, this defaults to removing any white space.

e.g. print my_seq.lstrip("-")

See also the strip and rstrip methods.

rstrip(self, chars=None)

source code 

Returns a new Seq object with trailing (right) end stripped.

This behaves like the python string method of the same name.

Optional argument chars defines which characters to remove. If ommitted or None (default) then as for the python string method, this defaults to removing any white space.

e.g. Removing a nucleotide sequence's polyadenylation (poly-A tail):

>>> from Bio.Alphabet import IUPAC
>>> from Bio.Seq import Seq
>>> my_seq = Seq("CGGTACGCTTATGTCACGTAGAAAAAA", IUPAC.unambiguous_dna)
>>> my_seq
Seq('CGGTACGCTTATGTCACGTAGAAAAAA', IUPACUnambiguousDNA())
>>> my_seq.rstrip("A")
Seq('CGGTACGCTTATGTCACGTAG', IUPACUnambiguousDNA())

See also the strip and lstrip methods.

upper(self)

source code 

Returns an upper case copy of the sequence.

>>> from Bio.Alphabet import HasStopCodon, generic_protein
>>> from Bio.Seq import Seq
>>> my_seq = Seq("VHLTPeeK*", HasStopCodon(generic_protein))
>>> my_seq
Seq('VHLTPeeK*', HasStopCodon(ProteinAlphabet(), '*'))
>>> my_seq.lower()
Seq('vhltpeek*', HasStopCodon(ProteinAlphabet(), '*'))
>>> my_seq.upper()
Seq('VHLTPEEK*', HasStopCodon(ProteinAlphabet(), '*'))

This will adjust the alphabet if required. See also the lower method.

lower(self)

source code 

Returns a lower case copy of the sequence.

This will adjust the alphabet if required. Note that the IUPAC alphabets are upper case only, and thus a generic alphabet must be substituted.

>>> from Bio.Alphabet import Gapped, generic_dna
>>> from Bio.Alphabet import IUPAC
>>> from Bio.Seq import Seq
>>> my_seq = Seq("CGGTACGCTTATGTCACGTAG*AAAAAA", Gapped(IUPAC.unambiguous_dna, "*"))
>>> my_seq
Seq('CGGTACGCTTATGTCACGTAG*AAAAAA', Gapped(IUPACUnambiguousDNA(), '*'))
>>> my_seq.lower()
Seq('cggtacgcttatgtcacgtag*aaaaaa', Gapped(DNAAlphabet(), '*'))

See also the upper method.

complement(self)

source code 

Returns the complement sequence. New Seq object.

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC
>>> my_dna = Seq("CCCCCGATAG", IUPAC.unambiguous_dna)
>>> my_dna
Seq('CCCCCGATAG', IUPACUnambiguousDNA())
>>> my_dna.complement()
Seq('GGGGGCTATC', IUPACUnambiguousDNA())

You can of course used mixed case sequences,

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_dna
>>> my_dna = Seq("CCCCCgatA-GD", generic_dna)
>>> my_dna
Seq('CCCCCgatA-GD', DNAAlphabet())
>>> my_dna.complement()
Seq('GGGGGctaT-CH', DNAAlphabet())

Note in the above example, ambiguous character D denotes G, A or T so its complement is H (for C, T or A).

Trying to complement a protein sequence raises an exception.

>>> my_protein = Seq("MAIVMGR", IUPAC.protein)
>>> my_protein.complement()
Traceback (most recent call last):
   ...
ValueError: Proteins do not have complements!

reverse_complement(self)

source code 

Returns the reverse complement sequence. New Seq object.

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC
>>> my_dna = Seq("CCCCCGATAGNR", IUPAC.ambiguous_dna)
>>> my_dna
Seq('CCCCCGATAGNR', IUPACAmbiguousDNA())
>>> my_dna.reverse_complement()
Seq('YNCTATCGGGGG', IUPACAmbiguousDNA())

Note in the above example, since R = G or A, its complement is Y (which denotes C or T).

You can of course used mixed case sequences,

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_dna
>>> my_dna = Seq("CCCCCgatA-G", generic_dna)
>>> my_dna
Seq('CCCCCgatA-G', DNAAlphabet())
>>> my_dna.reverse_complement()
Seq('C-TatcGGGGG', DNAAlphabet())

Trying to complement a protein sequence raises an exception:

>>> my_protein = Seq("MAIVMGR", IUPAC.protein)
>>> my_protein.reverse_complement()
Traceback (most recent call last):
   ...
ValueError: Proteins do not have complements!

transcribe(self)

source code 

Returns the RNA sequence from a DNA sequence. New Seq object.

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC
>>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG",
...                  IUPAC.unambiguous_dna)
>>> coding_dna
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG', IUPACUnambiguousDNA())
>>> coding_dna.transcribe()
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG', IUPACUnambiguousRNA())

Trying to transcribe a protein or RNA sequence raises an exception:

>>> my_protein = Seq("MAIVMGR", IUPAC.protein)
>>> my_protein.transcribe()
Traceback (most recent call last):
   ...
ValueError: Proteins cannot be transcribed!

back_transcribe(self)

source code 

Returns the DNA sequence from an RNA sequence. New Seq object.

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC
>>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG",
...                     IUPAC.unambiguous_rna)
>>> messenger_rna
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG', IUPACUnambiguousRNA())
>>> messenger_rna.back_transcribe()
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG', IUPACUnambiguousDNA())

Trying to back-transcribe a protein or DNA sequence raises an exception:

>>> my_protein = Seq("MAIVMGR", IUPAC.protein)
>>> my_protein.back_transcribe()
Traceback (most recent call last):
   ...
ValueError: Proteins cannot be back transcribed!

translate(self, table='Standard', stop_symbol='*', to_stop=False, cds=False)

source code 

Turns a nucleotide sequence into a protein sequence. New Seq object.

This method will translate DNA or RNA sequences, and those with a nucleotide or generic alphabet. Trying to translate a protein sequence raises an exception.

Arguments:

  • table - Which codon table to use? This can be either a name (string), an NCBI identifier (integer), or a CodonTable object (useful for non-standard genetic codes). This defaults to the "Standard" table.
  • stop_symbol - Single character string, what to use for terminators. This defaults to the asterisk, "*".
  • to_stop - Boolean, defaults to False meaning do a full translation continuing on past any stop codons (translated as the specified stop_symbol). If True, translation is terminated at the first in frame stop codon (and the stop_symbol is not appended to the returned protein sequence).
  • cds - Boolean, indicates this is a complete CDS. If True, this checks the sequence starts with a valid alternative start codon (which will be translated as methionine, M), that the sequence length is a multiple of three, and that there is a single in frame stop codon at the end (this will be excluded from the protein sequence, regardless of the to_stop option). If these tests fail, an exception is raised.

e.g. Using the standard table:

>>> coding_dna = Seq("GTGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG")
>>> coding_dna.translate()
Seq('VAIVMGR*KGAR*', HasStopCodon(ExtendedIUPACProtein(), '*'))
>>> coding_dna.translate(stop_symbol="@")
Seq('VAIVMGR@KGAR@', HasStopCodon(ExtendedIUPACProtein(), '@'))
>>> coding_dna.translate(to_stop=True)
Seq('VAIVMGR', ExtendedIUPACProtein())

Now using NCBI table 2, where TGA is not a stop codon:

>>> coding_dna.translate(table=2)
Seq('VAIVMGRWKGAR*', HasStopCodon(ExtendedIUPACProtein(), '*'))
>>> coding_dna.translate(table=2, to_stop=True)
Seq('VAIVMGRWKGAR', ExtendedIUPACProtein())

In fact, GTG is an alternative start codon under NCBI table 2, meaning this sequence could be a complete CDS:

>>> coding_dna.translate(table=2, cds=True)
Seq('MAIVMGRWKGAR', ExtendedIUPACProtein())

It isn't a valid CDS under NCBI table 1, due to both the start codon and also the in frame stop codons:

>>> coding_dna.translate(table=1, cds=True)
Traceback (most recent call last):
    ...
TranslationError: First codon 'GTG' is not a start codon

If the sequence has no in-frame stop codon, then the to_stop argument has no effect:

>>> coding_dna2 = Seq("TTGGCCATTGTAATGGGCCGC")
>>> coding_dna2.translate()
Seq('LAIVMGR', ExtendedIUPACProtein())
>>> coding_dna2.translate(to_stop=True)
Seq('LAIVMGR', ExtendedIUPACProtein())

NOTE - Ambiguous codons like "TAN" or "NNN" could be an amino acid or a stop codon. These are translated as "X". Any invalid codon (e.g. "TA?" or "T-A") will throw a TranslationError.

NOTE - Does NOT support gapped sequences.

NOTE - This does NOT behave like the python string's translate method. For that use str(my_seq).translate(...) instead.

ungap(self, gap=None)

source code 

Return a copy of the sequence without the gap character(s).

The gap character can be specified in two ways - either as an explicit argument, or via the sequence's alphabet. For example:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_dna
>>> my_dna = Seq("-ATA--TGAAAT-TTGAAAA", generic_dna)
>>> my_dna
Seq('-ATA--TGAAAT-TTGAAAA', DNAAlphabet())
>>> my_dna.ungap("-")
Seq('ATATGAAATTTGAAAA', DNAAlphabet())

If the gap character is not given as an argument, it will be taken from the sequence's alphabet (if defined). Notice that the returned sequence's alphabet is adjusted since it no longer requires a gapped alphabet:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC, Gapped, HasStopCodon
>>> my_pro = Seq("MVVLE=AD*", HasStopCodon(Gapped(IUPAC.protein, "=")))
>>> my_pro
Seq('MVVLE=AD*', HasStopCodon(Gapped(IUPACProtein(), '='), '*'))
>>> my_pro.ungap()
Seq('MVVLEAD*', HasStopCodon(IUPACProtein(), '*'))

Or, with a simpler gapped DNA example:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC, Gapped
>>> my_seq = Seq("CGGGTAG=AAAAAA", Gapped(IUPAC.unambiguous_dna, "="))
>>> my_seq
Seq('CGGGTAG=AAAAAA', Gapped(IUPACUnambiguousDNA(), '='))
>>> my_seq.ungap()
Seq('CGGGTAGAAAAAA', IUPACUnambiguousDNA())

As long as it is consistent with the alphabet, although it is redundant, you can still supply the gap character as an argument to this method:

>>> my_seq
Seq('CGGGTAG=AAAAAA', Gapped(IUPACUnambiguousDNA(), '='))
>>> my_seq.ungap("=")
Seq('CGGGTAGAAAAAA', IUPACUnambiguousDNA())

However, if the gap character given as the argument disagrees with that declared in the alphabet, an exception is raised:

>>> my_seq
Seq('CGGGTAG=AAAAAA', Gapped(IUPACUnambiguousDNA(), '='))
>>> my_seq.ungap("-")
Traceback (most recent call last):
   ...
ValueError: Gap '-' does not match '=' from alphabet

Finally, if a gap character is not supplied, and the alphabet does not define one, an exception is raised:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_dna
>>> my_dna = Seq("ATA--TGAAAT-TTGAAAA", generic_dna)
>>> my_dna
Seq('ATA--TGAAAT-TTGAAAA', DNAAlphabet())
>>> my_dna.ungap()
Traceback (most recent call last):
   ...
ValueError: Gap character not given and not defined in alphabet

Property Details [hide private]

data

Sequence as a string (DEPRECATED).

This is a read only property provided for backwards compatility with older versions of Biopython (as is the tostring() method). We now encourage you to use str(my_seq) instead of my_seq.data or the method my_seq.tostring().

In recent releases of Biopython it was possible to change a Seq object by updating its data property, but this triggered a deprecation warning. Now the data property is read only, since Seq objects are meant to be immutable:

>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import generic_dna
>>> my_seq = Seq("ACGT", generic_dna)
>>> str(my_seq) == my_seq.tostring() == "ACGT"
True
>>> my_seq.data = "AAAA"
Traceback (most recent call last):
   ...
AttributeError: can't set attribute
Get Method:
unreachable.data(self) - Sequence as a string (DEPRECATED).